Indre > Nyheder > Virksomhedsnyheder

[Gode nyheder] Babio er glad for at nævne ISO 13485 kvalitetsstyringssystemcertifikat igen

2022-01-11

For nylig bestod vores virksomhed med succes den indledende gennemgang og gengennemgang af ISO13485:2016 /EN ISO13485:2016-kvalitetssystemcertificeringen af ​​SGS-certificeringsorganet og opnåede den internationale ISO13485-kvalitetsstyringssystemcertificering udstedt af SGS-certificeringsorganet. Erhvervelsen af ​​dette certifikat er tredje gang, at vores virksomhed har opnået den internationale kvalitetssystemcertificering efter at have bestået Huaguang-certificeringen og ITS (Tianxiang Group)-certificeringen.


ISO13485-standarden er den generelle standard for den internationale industri for medicinsk udstyr, og den indenlandske industri for medicinsk udstyr har altid taget ISO13485-standarden som et vigtigt grundlag for kvalitetsstyringssystemcertificering. Omfanget af denne certificering er hovedsageligt forskning og udvikling, produktion og salg af virksomhedens "nye krone", "influenza" og andre højpatogene infektiøse serier af diagnostiske reagenser. Standardisering, videnskabelighed og standardisering har igen opnået international anerkendelse, hvilket er befordrende for virksomhedens ekspansion på oversøiske markeder.

OmBaibo

Jinan Biotech Co., Ltd. blev etableret i 2003 og er en højteknologisk virksomhed med speciale i forskning, udvikling, produktion og salg af in vitrodiagnostiske reagenser. Den 30. maj 2014 blev virksomheden med succes noteret på NEEQ (aktienavn: BaBio, aktiekode: 830774), og blev en af ​​de første indenlandske børsnoterede in vitro-diagnostiske reagenser efter udvidelsen af ​​NEEQ. I juni 2021,Baibokom officielt ind i innovationslaget i den nye tredje bestyrelse.


Produkterne omfatter hovedsageligt:VirustransportmediumSerier, Sterile og FlockingVatpindeserie,antigen/antistof hurtig diagnose- og påvisningsserie, Kitmikrobielle reagenser/tidsbestemt undersøgelsesreagensserier, serier til gynækologisk påvisning, serier af biokemiske reagenser, serier med medicinsk udstyr/robotter,Andre serier af kolloid guldsåsom kvindersgraviditetstestserie, HelicobacterpyloriIgg/igm testkit, Mycoplasma pneumoniae Igmtest kit, humant rotavirus antigen testsæt osv.


Efter mere end ti års teknologiakkumulering, innovation og forbedring af udstyr,BaBioer blevet en dyb kultivator inden for mikrobiologi og er en af ​​de få indenlandske producenter af mikrobiologiske reagenser med to fuldautomatiske produktionslinjer. Det mikrobielle prøveforbehandlingssystem, der er udviklet uafhængigt af Biotechnology, har udfyldt hullet i det indenlandske mikrobielle prøvebehandlingsfelt. Det er blevet brugt i China Intelligent Manufacturing International Summit Forum og China Intelligent Industry Innovation and Entrepreneurship Conference, og "Chuangzhixing" Cup China In Vitro Diagnostic Excellent Innovative Product Contests og andre konkurrencer vandt priser. Samtidig med det globale epidemiudbrud i 2020,BaBiohar spillet en vigtig rolle i de virusprøveudtagnings- og påvisningsprodukter, der er produceret af fordelene ved mange års professionel forskning, kvalitetsstyringskapaciteter og fuldt automatiseret produktionsudstyr under epidemien.